PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK38704.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family MYB
Protein Properties Length: 240aa    MW: 27206.7 Da    PI: 8.3797
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK38704.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-171966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEde+lv  vk+ G g+W++ +++ g+ R++k+c++rw +yl
       KFK38704.1 19 RGPWTVEEDEILVSFVKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYL 66
                     89******************************99************97 PP

2Myb_DNA-binding49.41.1e-1573117248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g  T +E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
       KFK38704.1  73 GGITSDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 117
                      56699****************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-221069IPR009057Homeodomain-like
PROSITE profilePS5129417.0991466IPR017930Myb domain
SuperFamilySSF466891.24E-2915113IPR009057Homeodomain-like
SMARTSM007171.1E-131868IPR001005SANT/Myb domain
PfamPF002491.8E-151966IPR001005SANT/Myb domain
CDDcd001671.79E-112166No hitNo description
PROSITE profilePS5129423.96967121IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-2470122IPR009057Homeodomain-like
SMARTSM007171.1E-1471119IPR001005SANT/Myb domain
PfamPF002493.6E-1474117IPR001005SANT/Myb domain
CDDcd001671.55E-1176117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MKSVSKKTTP CCTKMGMKRG PWTVEEDEIL VSFVKKEGEG RWRSLPKRAG LLRCGKSCRL  60
RWMNYLRPTV KRGGITSDEE DLILRLHRLL GNRWSLIAGR IPGRTDNEIK NYWNTHLRKK  120
LIRQGIDPQT HKPLDDNNIH KREEEVSGDG QIPLKPRSID HTDTTTSSGD GASKISVFGD  180
EEDNNDFGFC YDEKFSSFLN SLINDDPFDS NVPISQPLPK HTCADEIVGT SSSLGHDQRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27171215108B-MYB
1h8a_C5e-271712125128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195871e-156AY519587.1 Arabidopsis thaliana MYB transcription factor (At3g13540) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010500684.11e-140PREDICTED: transcription repressor MYB5 isoform X1
SwissprotQ388501e-139MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A087H9A21e-179A0A087H9A2_ARAAL; Uncharacterized protein
STRINGAT3G13540.11e-137(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.11e-134myb domain protein 5